PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_7DS_016F8E2EA.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family FAR1
Protein Properties Length: 727aa    MW: 81919.4 Da    PI: 6.5032
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_7DS_016F8E2EA.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR172.11.2e-22106192290
                   FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHel 89 
                             Y++Y++++GFsvrk k+++ + +++i ++++ Cskeg +e ek +  +e+ + ++trt+C+a+++ + +++g+w+v++l+++HnH+l
  Traes_7DS_016F8E2EA.1 106 LYCDYGHRTGFSVRKGKQSYFTGTKRIRTKDYFCSKEGLKEAEKLT--DENFNDPHTRTNCRAMVRFRANSQGEWRVIRLVSDHNHNL 191
                            7*****************************************9988..9999***********************************9 PP

                   FAR1  90 a 90 
                            +
  Traes_7DS_016F8E2EA.1 192 V 192
                            7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031014.6E-20106192IPR004330FAR1 DNA binding domain
PfamPF105511.8E-27316410IPR018289MULE transposase domain
PROSITE profilePS509669.606599635IPR007527Zinc finger, SWIM-type
SMARTSM005750.0036610637IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 727 aa     Download sequence    Send to blast
MVNTDGEGAD AGGGDPMCVD ESAGPVVVGA DQCEGARLQD SGAAVGIEET REGQVPVSHP  60
GGGMRVRGAT VEEAENEEAP TVQGSKEGAE ELLLKVVYSE EEAYKLYCDY GHRTGFSVRK  120
GKQSYFTGTK RIRTKDYFCS KEGLKEAEKL TDENFNDPHT RTNCRAMVRF RANSQGEWRV  180
IRLVSDHNHN LVRPEERHLL RSAKSLIAGR SCSAADAVLC GGYQLGGVPS QMAASTSVTN  240
NAETPRQDLL PGFSGITRTS AVGTGELQRI VSHLKSRANL DGMFYWDVQL DRAGRMSNFF  300
WRDGRSRMDY DCFGDVVVFD STYRLNKQNY IVAPFVGVNH HWQTTMYGCA LLADDSMSSF  360
TWLFKSFLEA MGNRQPRSIF TNQDQVMSNA IEEVLPNTCH RIAHWHIQKN AASRLGALNA  420
SKAFNKMFTK CMQGCDTEAE FEGTWAAMLR EFKLQDNKWL SKLYKLKQKW CGALNKCTFD  480
GGVENEPQCD SLSNIFTCIV DKSTSLSTIV AAVDKLTEDW REKEFDEDVR CCQRPLSCII  540
KHSDILNHAA KVYTHRIYKL FETYFLDGCG ATKFKALPCE DSDTYRFEMT MQGRGSRVCT  600
VHLNMSTMQL TCSCSQFETM GLLCPHTLKA LSIKNVGKIP EIYILKRWTR DAKQWVFNPK  660
QYESSYQECM DDEAGYCNHA MRYAYDLVMK SEGQEELRRS LWEALEGGEK ELEKYQNATQ  720
YAQSYAT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010236809.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 7-like
RefseqXP_014756443.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 7-like
RefseqXP_014756444.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 7-like
TrEMBLW5I4W80.0W5I4W8_WHEAT; Uncharacterized protein
STRINGMLOC_43316.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1832967
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.13e-85FAR1-related sequence 5
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]